Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIPK1 Rabbit Polyclonal Antibody (Biotin)

HIPK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Myak, Nbak2

UniProt

Q86Z02

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIPK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Vinculin Antibody (rVCL/7287) [Alexa Fluor 405]
NBP3-21062AF405 0.1 mL

Mouse Monoclonal Vinculin Antibody (rVCL/7287) [Alexa Fluor 405]

Sign In for Pricing
View Details
RN5S38 AAV Vector (Human) (CMV)
39962101 1 µg

RN5S38 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2462953 100 µL

GRTP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Guinea Pig TATA Box Binding Protein ELISA kit
GTR10431032 96 Well

Guinea Pig TATA Box Binding Protein ELISA kit

Sign In for Pricing
View Details
Oxytocin R Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1314R-BF750-TR 20 µL

Oxytocin R Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Sheep Glucagon-like peptide 1, GLP-1 ELISA KIT
E0205Sh-01 48 Well

Sheep Glucagon-like peptide 1, GLP-1 ELISA KIT

Sign In for Pricing
View Details