Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIPK1 Rabbit Polyclonal Antibody (FITC)

HIPK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Myak, Nbak2

UniProt

Q86Z02

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIPK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stability Test Chamber BTST-202-A
BTST-202-A 1 Unit

Stability Test Chamber BTST-202-A

Sign In for Pricing
View Details
Recombinant Human CXADR/CAR Protein (His Tag)
PKSH031424 100 µg

Recombinant Human CXADR/CAR Protein (His Tag)

Sign In for Pricing
View Details
GFP (Ads. to Hu, Ms, Rt Serum Proteins) Rabbit Polyclonal Antibody
AP09218PU-N 100 µg

GFP (Ads. to Hu, Ms, Rt Serum Proteins) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP8 (NM_005154) Human Recombinant Protein
TP316926 20 µg

USP8 (NM_005154) Human Recombinant Protein

Sign In for Pricing
View Details
M-CSF (CSF1) Mouse Monoclonal Antibody [Clone ID: OTI1D10]
CF806556 100 µg

M-CSF (CSF1) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

Sign In for Pricing
View Details
CMV-p65 (CMV101), CF568 conjugate, 0.1mg/mL
BNC680101-100 1x 100 µL

CMV-p65 (CMV101), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details