Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIPK1 Rabbit Polyclonal Antibody (HRP)

HIPK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Myak, Nbak2

UniProt

Q86Z02

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIPK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit
RD-MELK-Hu-01 96 Tests

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit

Sign In for Pricing
View Details
Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit
RD-MELK-Hu-02 48 Tests

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit

Sign In for Pricing
View Details
Recombinant RSK3 Monoclonal Antibody
E-AB-81605-01 50 µL

Recombinant RSK3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant RSK3 Monoclonal Antibody
E-AB-81605-02 100 µL

Recombinant RSK3 Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-MCM2 (S108) Recombinant Rabbit Monoclonal Antibody [JE63-52]
HA721021 100 µL

Phospho-MCM2 (S108) Recombinant Rabbit Monoclonal Antibody [JE63-52]

Sign In for Pricing
View Details
Perforin (PRF1) (NM_001083116) Human Over-expression Lysate
LC421209 20 µg

Perforin (PRF1) (NM_001083116) Human Over-expression Lysate

Sign In for Pricing
View Details