Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM79B Rabbit Polyclonal Antibody (Biotin)

FAM79B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM79B

UniProt

Q6ZUI0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FAM79B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_940887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit
ELK7140-01 48 Tests

Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit

Sign In for Pricing
View Details
Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit
ELK7140-02 96 Tests

Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit

Sign In for Pricing
View Details
Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit
ELK7140-03 5x 96 Tests

Human WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2) ELISA Kit

Sign In for Pricing
View Details
Human REXO2 shRNA Plasmid
abx958640-01 150 µg

Human REXO2 shRNA Plasmid

Sign In for Pricing
View Details
Human REXO2 shRNA Plasmid
abx958640-02 300 µg

Human REXO2 shRNA Plasmid

Sign In for Pricing
View Details
SYNPR Human shRNA Plasmid Kit (Locus ID 132204)
TL301283 1 Kit

SYNPR Human shRNA Plasmid Kit (Locus ID 132204)

Sign In for Pricing
View Details