Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHLRC2 Rabbit Polyclonal Antibody (HRP)

NHLRC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FINCA

UniProt

Q8NBF2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NHLRC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_940916

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXC1 ELISA Kit (Mouse) (OKCA00892)
OKCA00892 96 Well

FOXC1 ELISA Kit (Mouse) (OKCA00892)

Sign In for Pricing
View Details
Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag
056582-01 10 µg

Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag
056582-02 50 µg

Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag
056582-03 100 µg

Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag
056582-04 200 µg

Defensin Alpha 1B (DEFa1B), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
IFNAR1 (Interferon alpha/beta Receptor 1, IFN-R-1, IFN-alpha/beta Receptor 1, Cytokine Receptor Class-II Member 1, Cytokine Receptor Family 2 Member 1, CRF2-1, Type I Interferon Receptor 1, IFNAR) (APC)
128295-APC 100 µL

IFNAR1 (Interferon alpha/beta Receptor 1, IFN-R-1, IFN-alpha/beta Receptor 1, Cytokine Receptor Class-II Member 1, Cytokine Receptor Family 2 Member 1, CRF2-1, Type I Interferon Receptor 1, IFNAR) (APC)

Sign In for Pricing
View Details