Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf62 Rabbit Polyclonal Antibody (Biotin)

C3orf62 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAPS

UniProt

Q6ZUJ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf62

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag
058585-01 10 µg

Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag
058585-02 50 µg

Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag
058585-03 100 µg

Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag
058585-04 200 µg

Signal Transducer And Activator Of Transcription 3 (STAT3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Lentiviral human FZD2 sgRNA gene knockout kit - Lentiviral human FZD2 sgRNA gene knockout kit (plasmid)
GTR15356972 1 Vial

Lentiviral human FZD2 sgRNA gene knockout kit - Lentiviral human FZD2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rabbit Polyclonal STPG2 Antibody
NBP3-25163 100 µL

Rabbit Polyclonal STPG2 Antibody

Sign In for Pricing
View Details