Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Simc1 Rabbit Polyclonal Antibody (FITC)

Simc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4732471D19Rik

UniProt

E9Q6E9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: STSLLKCQSDKTQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_795961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (AP) discontinued
C2399-07E-AP 100 µL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Human WSC domain-containing protein 2 (WSCD2)
MBS7033633-01 0.02 mg

Recombinant Human WSC domain-containing protein 2 (WSCD2)

Sign In for Pricing
View Details
Recombinant Human WSC domain-containing protein 2 (WSCD2)
MBS7033633-02 0.1 mg

Recombinant Human WSC domain-containing protein 2 (WSCD2)

Sign In for Pricing
View Details
Recombinant Human WSC domain-containing protein 2 (WSCD2)
MBS7033633-03 5x 0.1 mg

Recombinant Human WSC domain-containing protein 2 (WSCD2)

Sign In for Pricing
View Details
TIE2 (pY1108) Antibody
MBS8581094-01 0.1 mL

TIE2 (pY1108) Antibody

Sign In for Pricing
View Details
TIE2 (pY1108) Antibody
MBS8581094-02 0.1 mL (AF635)

TIE2 (pY1108) Antibody

Sign In for Pricing
View Details