Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Simc1 Rabbit Polyclonal Antibody (HRP)

Simc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4732471D19Rik

UniProt

E9Q6E9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STSLLKCQSDKTQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_795961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRG3 (NM_006093) Human Recombinant Protein
TP720723M 50 µg

PRG3 (NM_006093) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 sucB Polyclonal Antibody
MBS7138872 Inquire

Rabbit anti-Escherichia coli O157:H7 sucB Polyclonal Antibody

Sign In for Pricing
View Details
M/M069/NL537-PEUL-100X50/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
321220 1 Pack (1 Panel (s) x 1 Pack)

M/M069/NL537-PEUL-100X50/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rat Sjogren Syndrome Antigen B (SSB) ELISA Kit
RD-SSB-Ra-01 96 Tests

Rat Sjogren Syndrome Antigen B (SSB) ELISA Kit

Sign In for Pricing
View Details
Rat Sjogren Syndrome Antigen B (SSB) ELISA Kit
RD-SSB-Ra-02 48 Tests

Rat Sjogren Syndrome Antigen B (SSB) ELISA Kit

Sign In for Pricing
View Details
ZNF93 Polyclonal Antibody, RBITC Conjugated
bs-13558R-RBITC 100 µL

ZNF93 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details