Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB15 Rabbit Polyclonal Antibody (HRP)

RAB15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P59190

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAB15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_941959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHGA Rabbit Polyclonal Antibody (PE-Cy5)
orb2418388 100 µL

CHGA Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Olfr598 (NM_001011793) Mouse Tagged ORF Clone Lentiviral Particle
MR213441L4V 200 µL

Olfr598 (NM_001011793) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Morg1 Recombinant Protein Antigen
NBP1-92132PEP 0.1 mL

Morg1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bovine Septin 5 ELISA Kit
MBS077930-01 48 Well

Bovine Septin 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Septin 5 ELISA Kit
MBS077930-02 96 Well

Bovine Septin 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Septin 5 ELISA Kit
MBS077930-03 5x 96 Well

Bovine Septin 5 ELISA Kit

Sign In for Pricing
View Details