Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB15 Rabbit Polyclonal Antibody (Biotin)

RAB15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P59190

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_941959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM12 siRNA (Human)
orb1853475-01 15 nmol

LSM12 siRNA (Human)

Sign In for Pricing
View Details
LSM12 siRNA (Human)
orb1853475-02 30 nmol

LSM12 siRNA (Human)

Sign In for Pricing
View Details
GENLISA Mouse Bone Morphogenetic Protein 2 (BMP2) ELISA
KLM3435 1x 96 Well

GENLISA Mouse Bone Morphogenetic Protein 2 (BMP2) ELISA

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Prostate-specific, APS, Gamma-seminoprotein, hK3, Kallikrein related peptidase 3, Kallikrein-3, KLK3, KLK2A1, P-30 antigen, Semenogelase, Seminin) (BSA & Azide Free) (MaxLight 405)
MBS6194032-01 0.1 mL

Prostate Specific Antigen (PSA, Prostate-specific, APS, Gamma-seminoprotein, hK3, Kallikrein related peptidase 3, Kallikrein-3, KLK3, KLK2A1, P-30 antigen, Semenogelase, Seminin) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Prostate-specific, APS, Gamma-seminoprotein, hK3, Kallikrein related peptidase 3, Kallikrein-3, KLK3, KLK2A1, P-30 antigen, Semenogelase, Seminin) (BSA & Azide Free) (MaxLight 405)
MBS6194032-02 5x 0.1 mL

Prostate Specific Antigen (PSA, Prostate-specific, APS, Gamma-seminoprotein, hK3, Kallikrein related peptidase 3, Kallikrein-3, KLK3, KLK2A1, P-30 antigen, Semenogelase, Seminin) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
Fish Leptin (LEP) ELISA Kit
AE35762FI-01 48 Tests

Fish Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details