Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPE-PLD Rabbit Polyclonal Antibody (HRP)

NAPE-PLD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FMP30, C7orf18, NAPE-PLD

UniProt

Q6IQ20

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_945341

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663) (PE)
MBS6383992-01 0.1 mL

KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663) (PE)

Sign In for Pricing
View Details
KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663) (PE)
MBS6383992-02 5x 0.1 mL

KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663) (PE)

Sign In for Pricing
View Details
FJX1 siRNA (Mouse)
CRM1373-01 15 nmol

FJX1 siRNA (Mouse)

Sign In for Pricing
View Details
FJX1 siRNA (Mouse)
CRM1373-02 30 nmol

FJX1 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus lrgB Protein (aa 1-233) (strain Mu50 / ATCC 700699)
VAng-Cr5868-inquire Inquire

Recombinant Staphylococcus Aureus lrgB Protein (aa 1-233) (strain Mu50 / ATCC 700699)

Sign In for Pricing
View Details
CD354/TREM1 Protein (N-His, Mus musculus (Mouse) )
P502040 100 µg

CD354/TREM1 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details