Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPE-PLD Rabbit Polyclonal Antibody (HRP)

NAPE-PLD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FMP30, C7orf18, NAPE-PLD

UniProt

Q6IQ20

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_945341

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hu CD103 Purified, clone Ber-ACT8 (Monoclonal) Antibody
orb1882564 0.1 mg

Mouse Hu CD103 Purified, clone Ber-ACT8 (Monoclonal) Antibody

Sign In for Pricing
View Details
KHSRP (KH-Type Splicing Regulatory Protein, FBP2, FUBP2, KSRP, MGC99676) (MaxLight 550)
247849-ML550 100 µL

KHSRP (KH-Type Splicing Regulatory Protein, FBP2, FUBP2, KSRP, MGC99676) (MaxLight 550)

Sign In for Pricing
View Details
RAB8B Conjugated Antibody
MBS9448291-01 0.1 mL (Biotin)

RAB8B Conjugated Antibody

Sign In for Pricing
View Details
RAB8B Conjugated Antibody
MBS9448291-02 0.1 mL (AF350)

RAB8B Conjugated Antibody

Sign In for Pricing
View Details
RAB8B Conjugated Antibody
MBS9448291-03 0.1 mL (AF405)

RAB8B Conjugated Antibody

Sign In for Pricing
View Details
RAB8B Conjugated Antibody
MBS9448291-04 0.1 mL (AF488)

RAB8B Conjugated Antibody

Sign In for Pricing
View Details