Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPEPLD Rabbit Polyclonal Antibody (HRP)

NAPEPLD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FMP30, C7orf18, NAPE-PLD

UniProt

Q6IQ20

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NAPEPLD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001116310.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ANKRD13A Antibody [DyLight 680]
NBP3-18496FR 0.1 mL

Rabbit Polyclonal ANKRD13A Antibody [DyLight 680]

Sign In for Pricing
View Details
Rabbit Anti ANGPTL4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422422-01 0.001 mL

Rabbit Anti ANGPTL4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti ANGPTL4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422422-02 5x 0.001 mL

Rabbit Anti ANGPTL4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
NIPA2 Protein Vector (Human) (pPB-N-His)
PV028334 500 ng

NIPA2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human Osteoglycin (OGN) ELISA Kit
orb2667770-01 48 Tests

Human Osteoglycin (OGN) ELISA Kit

Sign In for Pricing
View Details
Human Osteoglycin (OGN) ELISA Kit
orb2667770-02 96 Tests

Human Osteoglycin (OGN) ELISA Kit

Sign In for Pricing
View Details