Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC1 Rabbit Polyclonal Antibody (Biotin)

ERCC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UV20, COFS4, RAD10

UniProt

P07992

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ERCC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001159521.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid hormone related protein (PTHLH) (NM_002820) Human Over-expression Lysate
LC401000 20 µg

Parathyroid hormone related protein (PTHLH) (NM_002820) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PIGK siRNA
abx928569-01 15 nmol

Human PIGK siRNA

Sign In for Pricing
View Details
Human PIGK siRNA
abx928569-02 30 nmol

Human PIGK siRNA

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)
MBS1002520-01 0.02 mg (E-Coli)

Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)
MBS1002520-02 0.02 mg (Yeast)

Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)
MBS1002520-03 0.1 mg (E-Coli)

Recombinant Thermoanaerobacter pseudethanolicus V-type ATP synthase beta chain (atpB)

Sign In for Pricing
View Details