Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ercc1 Rabbit Polyclonal Antibody (Biotin)

Ercc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ercc-, Ercc-1

UniProt

Q91VP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNT Mouse mAb
C06715-100uL*2 2x 100μL

NNT Mouse mAb

Sign In for Pricing
View Details
PDSS2 (NM_020381) Human Tagged Lenti ORF Clone
RC207892L3 10 µg

PDSS2 (NM_020381) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103)
C2277-06Q1 250 µg

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103)

Sign In for Pricing
View Details
MED17 antibody
FNab10164 100 µg

MED17 antibody

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase IA-2 Beta, Receptor-type Tyrosine-protein Phosphatase N2, R-PTP-N2, Islet Cell Autoantigen-related Protein, IAR, ICAAR, Phogrin, KIAA0387) (MaxLight 405) discontinued
132080-ML405 100 µL

PTPRN2 (Protein Tyrosine Phosphatase IA-2 Beta, Receptor-type Tyrosine-protein Phosphatase N2, R-PTP-N2, Islet Cell Autoantigen-related Protein, IAR, ICAAR, Phogrin, KIAA0387) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PRKACA Rabbit Polyclonal Antibody
orb583733 100 µL

PRKACA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details