Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO33 Rabbit Polyclonal Antibody (FITC)

FBXO33 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fbx33, BMND12, c14_5247

UniProt

Q7Z6M2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBXO33

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_976046

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IKK alpha (Thr23) Rabbit Polyclonal Antibody (Cy5)
orb901680 100 µL

Phospho-IKK alpha (Thr23) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
JAG1 (Jagged 1 (Alagille Syndrome), AGS, AHD, AWS, CD339, HJ1, JAGL1, MGC104644) (MaxLight 550)
MBS6217679-01 0.1 mL

JAG1 (Jagged 1 (Alagille Syndrome), AGS, AHD, AWS, CD339, HJ1, JAGL1, MGC104644) (MaxLight 550)

Sign In for Pricing
View Details
JAG1 (Jagged 1 (Alagille Syndrome), AGS, AHD, AWS, CD339, HJ1, JAGL1, MGC104644) (MaxLight 550)
MBS6217679-02 5x 0.1 mL

JAG1 (Jagged 1 (Alagille Syndrome), AGS, AHD, AWS, CD339, HJ1, JAGL1, MGC104644) (MaxLight 550)

Sign In for Pricing
View Details
TNFRSF1A Antibody (HRP)
orb687497-01 50 μL

TNFRSF1A Antibody (HRP)

Sign In for Pricing
View Details
TNFRSF1A Antibody (HRP)
orb687497-02 100 µL

TNFRSF1A Antibody (HRP)

Sign In for Pricing
View Details
ANKRD32, NT (ANKRD32, BRCTD1, Ankyrin repeat domain-containing protein 32, BRCT domain-containing protein 1) (MaxLight 550) discontinued
031892-ML550 100 µL

ANKRD32, NT (ANKRD32, BRCTD1, Ankyrin repeat domain-containing protein 32, BRCT domain-containing protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details