Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC187 Rabbit Polyclonal Antibody (FITC)

CCDC187 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8IVT4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50722

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_976223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 650)
MBS6397718-01 0.1 mL

TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 650)

Sign In for Pricing
View Details
TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 650)
MBS6397718-02 5x 0.1 mL

TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 54 (TEX54)
orb3006595-01 20 µg

Recombinant Human Testis-expressed protein 54 (TEX54)

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 54 (TEX54)
orb3006595-02 100 µg

Recombinant Human Testis-expressed protein 54 (TEX54)

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 54 (TEX54)
orb3006595-03 1 mg

Recombinant Human Testis-expressed protein 54 (TEX54)

Sign In for Pricing
View Details
Rat Interleukin 23 Receptor (IL23R) ELISA Kit
MBS2705597-01 24 Strip Well

Rat Interleukin 23 Receptor (IL23R) ELISA Kit

Sign In for Pricing
View Details