Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC187 Rabbit Polyclonal Antibody (HRP)

CCDC187 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IVT4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50722

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_976223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (Azide free) (HRP)
MBS6494958-01 0.2 mL

PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (Azide free) (HRP)

Sign In for Pricing
View Details
PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (Azide free) (HRP)
MBS6494958-02 5x 0.2 mL

PSMB1, CT (Proteasome gamma Chain, Multicatalytic Endopeptidase Complex Subunit C5, Macropain Subunit C5, Proteasome Component C5, Proteasome Subunit beta Type-1, PSC5) (Azide free) (HRP)

Sign In for Pricing
View Details
Beta galactosidase Rabbit Polyclonal Antibody (BF350)
orb2416179 100 µL

Beta galactosidase Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
OR5D15P ORF Vector (Human) (pORF)
ORF026987 1.0 µg DNA

OR5D15P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CROCC Rabbit Polyclonal Antibody
orb3072310-01 30 µL

CROCC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CROCC Rabbit Polyclonal Antibody
orb3072310-02 50 µL

CROCC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details