Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAME Rabbit Polyclonal Antibody (FITC)

PRAME Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MAPE, OIP4, CT130, OIP-4

UniProt

P78395

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRAME

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_006106

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Native Bovine Aprotinin/Pancreatic Trypsin Inhibitor
B2016556-100MG 100 mg

Native Bovine Aprotinin/Pancreatic Trypsin Inhibitor

Sign In for Pricing
View Details
FABP5L6 3'UTR GFP Stable Cell Line
TU057192 1.0 mL

FABP5L6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human PRKAb1 (Protein Kinase, AMP Activated Beta 1) ELISA Kit
EH27000 96 Tests

Human PRKAb1 (Protein Kinase, AMP Activated Beta 1) ELISA Kit

Sign In for Pricing
View Details
Fahd1 3'UTR GFP Stable Cell Line
TU156086 1.0 mL

Fahd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
H2BC9 (NM_003524) Human Over-expression Lysate
LS008345 100 µg

H2BC9 (NM_003524) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Mesoderm-Specific Transcript Homolog Protein (MEST) ELISA Kit
MBS9901127-01 48 Well

Rat Mesoderm-Specific Transcript Homolog Protein (MEST) ELISA Kit

Sign In for Pricing
View Details