Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptotagmin-1 (Syt1)

Product Specifications

Product Name Alternative

(Synaptotagmin I) (SytI) (p65)

Abbreviation

Recombinant Rat Syt1 protein

Gene Name

Syt1

UniProt

P21707

Expression Region

1-421aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Cancer

Relevance

Calcium sensor that participates in triggering neurotransmitter release at the synapse. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca (2+) -dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca (2+) -independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes. ; (Microbial infection) Receptor for C.botulinum neurotoxin type B (BoNT/B, botB) ; interaction is improved in the presence of gangliosides. BoNT/B toxin binds to the membrane proximal vesicular domain of Syt1 (residues 32-51) . ; (Microbial infection) Receptor for C.botulinum neurotoxin type G (BoNT/G, botG) ; unlike the case with BoNT/B, interaction is not improved in the presence of gangliosides. BoNT/G toxin binds to the vesicular domain of Syt1 (residues 32-53) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.5 kDa

References & Citations

"Synaptotagmin-12, a synaptic vesicle phosphoprotein that modulates spontaneous neurotransmitter release." Maximov A., Shin O.H., Liu X., Suedhof T.C. J. Cell Biol. 176:113-124 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myostatin Propeptide (MSTN) Mouse Monoclonal Antibody [Clone ID: OTI7H5]
CF807788 100 µg

Myostatin Propeptide (MSTN) Mouse Monoclonal Antibody [Clone ID: OTI7H5]

Sign In for Pricing
View Details
N-Nitroso Desethyl Blonanserin
TRC-N576880-100MG 100 mg

N-Nitroso Desethyl Blonanserin

Sign In for Pricing
View Details
Human TBC1D3I activation kit by CRISPRa
GA119595 1 Kit

Human TBC1D3I activation kit by CRISPRa

Sign In for Pricing
View Details
PLCG 2 (PLCG2) Rabbit Polyclonal Antibody
AP06571PU-N 100 µg

PLCG 2 (PLCG2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-13175-01 20 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-13175-02 60 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details