Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd13d Rabbit Polyclonal Antibody (Biotin)

Ankrd13d Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI430801, 0710001P18Rik

UniProt

Q6PD24

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080996

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPFIA1, NT (PPFIA1, LIP1, Liprin-alpha-1, LAR-interacting protein 1, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (MaxLight 550)
MBS6336210-01 0.1 mL

PPFIA1, NT (PPFIA1, LIP1, Liprin-alpha-1, LAR-interacting protein 1, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (MaxLight 550)

Sign In for Pricing
View Details
PPFIA1, NT (PPFIA1, LIP1, Liprin-alpha-1, LAR-interacting protein 1, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (MaxLight 550)
MBS6336210-02 5x 0.1 mL

PPFIA1, NT (PPFIA1, LIP1, Liprin-alpha-1, LAR-interacting protein 1, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Fam189a2 shRNA (UAS) - Lentiviral mouse Fam189a2 shRNA (UAS, iRFP) (25)
GTR15226322 1 Vial

Lentiviral mouse Fam189a2 shRNA (UAS) - Lentiviral mouse Fam189a2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human IMPDH2 sgRNA gene knockout kit - Lentiviral human IMPDH2 sgRNA gene knockout kit (plasmid)
GTR15371027 1 Vial

Lentiviral human IMPDH2 sgRNA gene knockout kit - Lentiviral human IMPDH2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Anti Mouse CD326 Flow Cytometry Monoclonal Clone G88 PE/Cyanine7 Ready To Use 200 Tests
IRTAMSCD326G88CPECY7200 200 Tests

Anti Mouse CD326 Flow Cytometry Monoclonal Clone G88 PE/Cyanine7 Ready To Use 200 Tests

Sign In for Pricing
View Details
Recombinant Streptomyces lividans Tripeptidyl aminopeptidase (tap)
MBS1388117-01 0.02 mg (E-Coli)

Recombinant Streptomyces lividans Tripeptidyl aminopeptidase (tap)

Sign In for Pricing
View Details