Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd13d Rabbit Polyclonal Antibody (HRP)

Ankrd13d Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI430801, 0710001P18Rik

UniProt

Q6PD24

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080996

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza B Virus Victoria 504/00 (purified 7/6/2011, inactivated)
RP-1528 10 µg

Influenza B Virus Victoria 504/00 (purified 7/6/2011, inactivated)

Sign In for Pricing
View Details
Rabbit Monoclonal CLPS Antibody (111) [mFluor Violet 450 SE]
NBP2-90233MFV450 0.1 mL

Rabbit Monoclonal CLPS Antibody (111) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Brilliant Violet 711™ anti-human CD1c
GT10865 25 Tests

Brilliant Violet 711™ anti-human CD1c

Sign In for Pricing
View Details
NLN Medium;w/ Vitamins;w/o Calcium nitrate, Sucrose & Agar
PT094-10X1L 1 unit

NLN Medium;w/ Vitamins;w/o Calcium nitrate, Sucrose & Agar

Sign In for Pricing
View Details
Rab34 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3418703 1.0 µg DNA

Rab34 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARAC10 Polyclonal Antibody
MBS7182501 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARAC10 Polyclonal Antibody

Sign In for Pricing
View Details