Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf55 Rabbit Polyclonal Antibody (FITC)

C2orf55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C2orf55, KIAA1211L

UniProt

Q6NV74

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2orf55

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FEN1 (7H8) Mouse Monoclonal Antibody
MA2589-.05 50 µL

Anti-FEN1 (7H8) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit
MBS458683-01 48 Tests

Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit

Sign In for Pricing
View Details
Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit
MBS458683-02 96 Tests

Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit

Sign In for Pricing
View Details
Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit
MBS458683-03 5x 96 Tests

Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit

Sign In for Pricing
View Details
Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit
MBS458683-04 10x 96 Tests

Human Cross Linked C-Telopeptide Of Type III Collagen (CTXIII) ELISA Kit

Sign In for Pricing
View Details
FMNL1 3'UTR Luciferase Stable Cell Line
TU008040 1.0 mL

FMNL1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details