Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ35767 Rabbit Polyclonal Antibody (HRP)

FLJ35767 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NA77

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLJ35767

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_997342

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/XFD610 Anti-non-human primates/ human CD170 Antibody *1A5*
117001N1-AAT 100 Tests

PE/XFD610 Anti-non-human primates/ human CD170 Antibody *1A5*

Sign In for Pricing
View Details
Ccdc91 (NM_001014061) Rat Tagged ORF Clone Lentiviral Particle
RR213223L4V 200 µL

Ccdc91 (NM_001014061) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MDA5/IFIH1 Protein (C-His, Human)
P505927 100 µg

MDA5/IFIH1 Protein (C-His, Human)

Sign In for Pricing
View Details
PRI2 rabbit pAb
UB-GEN-11843 100 µL

PRI2 rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Rdh8 shRNA (UAS) - Lentiviral mouse Rdh8 shRNA (UAS, iRFP) plasmid
GTR15187456 1 Vial

Lentiviral mouse Rdh8 shRNA (UAS) - Lentiviral mouse Rdh8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PRR18 Human qPCR Template Standard (NM_175922)
HK205917 1 Kit

PRR18 Human qPCR Template Standard (NM_175922)

Sign In for Pricing
View Details