Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCSER1 Rabbit Polyclonal Antibody (HRP)

CCSER1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM190A

UniProt

Q9C0I3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CCSE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQS

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD92 (CD92 Antigen, CD92 Protein, CDw92, CDw92 Antigen, Choline Transporter-like Protein 1, CHTL1, CTL1, RP11-287A8.1, Solute Carrier Family 44 Member 1, SLC44A1) (AP) discontinued
C2441-98A-AP 100 µL

CD92 (CD92 Antigen, CD92 Protein, CDw92, CDw92 Antigen, Choline Transporter-like Protein 1, CHTL1, CTL1, RP11-287A8.1, Solute Carrier Family 44 Member 1, SLC44A1) (AP) discontinued

Sign In for Pricing
View Details
SBP2 Immunizing Peptide
orb16087 100 µg

SBP2 Immunizing Peptide

Sign In for Pricing
View Details
Dynamin 2 Rabbit Polyclonal Antibody (Cy7)
orb1052519 100 µL

Dynamin 2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Protein CASP Antibody (YA3184, Rabbit)
HY-P83439-01 10 µL

Protein CASP Antibody (YA3184, Rabbit)

Sign In for Pricing
View Details
Protein CASP Antibody (YA3184, Rabbit)
HY-P83439-02 50 μL

Protein CASP Antibody (YA3184, Rabbit)

Sign In for Pricing
View Details
Protein CASP Antibody (YA3184, Rabbit)
HY-P83439-03 100 µL

Protein CASP Antibody (YA3184, Rabbit)

Sign In for Pricing
View Details