Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX15 Rabbit Polyclonal Antibody (HRP)

ALOX15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LOG15, 12-LOX, 15-LOX, 15-LOX-1

UniProt

P16050

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP antibody
20R-1769 100 ug

GFP antibody

Sign In for Pricing
View Details
HSFX1, ID (HSFX1, LW-1, Heat shock transcription factor, X-linked) (MaxLight 550)
MBS6308591-01 0.1 mL

HSFX1, ID (HSFX1, LW-1, Heat shock transcription factor, X-linked) (MaxLight 550)

Sign In for Pricing
View Details
HSFX1, ID (HSFX1, LW-1, Heat shock transcription factor, X-linked) (MaxLight 550)
MBS6308591-02 5x 0.1 mL

HSFX1, ID (HSFX1, LW-1, Heat shock transcription factor, X-linked) (MaxLight 550)

Sign In for Pricing
View Details
Screw Caps
B91305 500 Caps/Bag

Screw Caps

Sign In for Pricing
View Details
Rat Thymic Stromal Lymphopoietin (TSLP) Protein
abx069290-01 10 µg

Rat Thymic Stromal Lymphopoietin (TSLP) Protein

Sign In for Pricing
View Details
Rat Thymic Stromal Lymphopoietin (TSLP) Protein
abx069290-02 50 µg

Rat Thymic Stromal Lymphopoietin (TSLP) Protein

Sign In for Pricing
View Details