Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALOX15 Rabbit Polyclonal Antibody (HRP)

ALOX15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LOG15, 12-LOX, 15-LOX, 15-LOX-1

UniProt

P16050

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG5 Protein Vector (Human) (pPB-His-MBP)
PV318882 500 ng

ABCG5 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Human NKX2-2 Recombinant Protein
PPT-14206 100 µg

Human NKX2-2 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human C12orf76 Protein
E30P12255 20 µg

Recombinant Human C12orf76 Protein

Sign In for Pricing
View Details
RSPH14 Antibody - middle region : FITC (ARP55056_P050-FITC)
ARP55056_P050-FITC 100 µL

RSPH14 Antibody - middle region : FITC (ARP55056_P050-FITC)

Sign In for Pricing
View Details
Cat Tetraspanin 30 ELISA Kit
MBS058724 Inquire

Cat Tetraspanin 30 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 23 (IL-23) ELISA Kit
NSL1912Hu 96 Tests

Human Interleukin 23 (IL-23) ELISA Kit

Sign In for Pricing
View Details