Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDOR1 Rabbit Polyclonal Antibody (Biotin)

NDOR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NR1, CIAE1, bA350O14.9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001716622

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1)
249690 200 µL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1)

Sign In for Pricing
View Details
Nitidine Chloride
300681 20 mg

Nitidine Chloride

Sign In for Pricing
View Details
Lentiviral mouse Gabrd shRNA (UAS) - Lentiviral mouse Gabrd shRNA (UAS, iRFP) (100)
GTR15225411 1 Vial

Lentiviral mouse Gabrd shRNA (UAS) - Lentiviral mouse Gabrd shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
(6-Bromo-2-methoxyquinolin-3-yl) boronic acid
GKD78257 1 g

(6-Bromo-2-methoxyquinolin-3-yl) boronic acid

Sign In for Pricing
View Details
Lentiviral mouse Cldn7 shRNA (UAS) - Lentiviral mouse Cldn7 shRNA (UAS, GFP) plasmid
GTR15257050 1 Vial

Lentiviral mouse Cldn7 shRNA (UAS) - Lentiviral mouse Cldn7 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (AP) discontinued
043137-AP 200 µL

TOR1B, CT (TOR1B, DQ1, Torsin-1B, Torsin family 1 member B) (AP) discontinued

Sign In for Pricing
View Details