Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDOR1 Rabbit Polyclonal Antibody (FITC)

NDOR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NR1, CIAE1, bA350O14.9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001716622

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclohexyl isovalerate
C31510 100 g

Cyclohexyl isovalerate

Sign In for Pricing
View Details
DNA Collection and Storage IABcard
IAF0100.05 5 PCS

DNA Collection and Storage IABcard

Sign In for Pricing
View Details
PRKAR1B, NT (cAMP-dependent Protein Kinase Type I-beta Regulatory Subunit) (MaxLight 405) discontinued
P9102-91L4-ML405 100 µL

PRKAR1B, NT (cAMP-dependent Protein Kinase Type I-beta Regulatory Subunit) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO
MW310012-01 50 µg

Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO
MW310012-02 100 µg

Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO
MW310012-03 1 mg

Recombinant Mouse GPC3/Glypican 3 Protein, N-His-SUMO

Sign In for Pricing
View Details