Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPNS2 Rabbit Polyclonal Antibody (FITC)

SPNS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DFNB115, SLC62A2, SLC63A2

UniProt

Q8IVW8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPNS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001118230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit
MBS9352097-01 48 Well

Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit

Sign In for Pricing
View Details
Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit
MBS9352097-02 96 Well

Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit

Sign In for Pricing
View Details
Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit
MBS9352097-03 5x 96 Well

Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit

Sign In for Pricing
View Details
Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit
MBS9352097-04 10x 96 Well

Porcine Endothelial PAS Domain-Containing Protein 1 (EPAS1) ELISA Kit

Sign In for Pricing
View Details
SNX18P15 ORF Vector (Human) (pORF)
ORF033120 1.0 µg DNA

SNX18P15 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FKBPL Rabbit Polyclonal Antibody
APRab11013-01 20 µL

FKBPL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details