Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mtm1 Rabbit Polyclonal Antibody (FITC)

Mtm1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mtm, AF073996, mKIAA4176

UniProt

B1AW21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001157664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF-β Antibody Blocking Peptide
orb73283 500 µg

TNF-β Antibody Blocking Peptide

Sign In for Pricing
View Details
Ribosomal Protein S6 Kinase 1 (RPS6K1) (APC) discontinued
R2031-39F-APC 100 µL

Ribosomal Protein S6 Kinase 1 (RPS6K1) (APC) discontinued

Sign In for Pricing
View Details
Human MSANTD4 Knockout HEK293T cell line
GTR15418403 1 Vial

Human MSANTD4 Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Human BMP-2 protein, No Tag
MBS1560703-01 0.05 mg

Recombinant Human BMP-2 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human BMP-2 protein, No Tag
MBS1560703-02 0.1 mg

Recombinant Human BMP-2 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human BMP-2 protein, No Tag
MBS1560703-03 5x 0.1 mg

Recombinant Human BMP-2 protein, No Tag

Sign In for Pricing
View Details