Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pepd Rabbit Polyclonal Antibody (FITC)

Pepd Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D, Pe, Pep, dal, Pep4, Pep-4

UniProt

Q11136

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Mitofusin 1 Antibody (11E9-1H12) [Alexa Fluor 488]
NBP1-71775AF488 0.1 mL

Mouse Monoclonal Mitofusin 1 Antibody (11E9-1H12) [Alexa Fluor 488]

Sign In for Pricing
View Details
FGF2 Recombinant Antibody, HRP Conjugated
bsm-34016R-HRP 100 µL

FGF2 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
ELK1P1 ORF Vector (Human) (pORF)
ORF018856 1.0 µg DNA

ELK1P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human MCM2 (Minichromosome Maintenance Deficient 2) ELISA Kit
EK241697 96 Well

Human MCM2 (Minichromosome Maintenance Deficient 2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cd164 shRNA (UAS) - Lentiviral mouse Cd164 shRNA (UAS, RFP) (100)
GTR15253800 1 Vial

Lentiviral mouse Cd164 shRNA (UAS) - Lentiviral mouse Cd164 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Histone H2B Antibody
A18093-50UG 50 µg

Histone H2B Antibody

Sign In for Pricing
View Details