Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPOX Rabbit Polyclonal Antibody (Biotin)

PPOX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VP, PPO, V290M

UniProt

P50336

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PPOX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000300.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FKBP25 Antibody [PerCP]
NBP3-00022PCP 0.1 mL

Rabbit Polyclonal FKBP25 Antibody [PerCP]

Sign In for Pricing
View Details
Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit
MBS7252860-01 48 Well

Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit
MBS7252860-02 96 Well

Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit
MBS7252860-03 5x 96 Well

Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit
MBS7252860-04 10x 96 Well

Rabbit Chloride channel CLIC-like protein 1 (CLCC1) ELISA Kit

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD38
GT13760 25 Tests

Alexa Fluor® 647 anti-human CD38

Sign In for Pricing
View Details