Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPOX Rabbit Polyclonal Antibody (FITC)

PPOX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VP, PPO, V290M

UniProt

P50336

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PPOX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000300.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-arrestin 2 Polyclonal Antibody
orb1417854 100 µL

Beta-arrestin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423124-01 0.12 mL

Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423124-02 0.2 mL

Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423124-03 5x 0.2 mL

Rabbit Anti CD38 Polyclonal Antigen affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
HSP90AB1 Antibody
orb570712-01 50 µg

HSP90AB1 Antibody

Sign In for Pricing
View Details
HSP90AB1 Antibody
orb570712-02 100 µg

HSP90AB1 Antibody

Sign In for Pricing
View Details