Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pros1 Rabbit Polyclonal Antibody (HRP)

Pros1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pros

UniProt

Q08761

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112348

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Solute carrier family 26 member 10 (SLC26A10) ELISA Kit
abx544281 96 Tests

Human Solute carrier family 26 member 10 (SLC26A10) ELISA Kit

Sign In for Pricing
View Details
Nipah virus/NiV N/Nucleo Protein (N-His-SUMO & C-Strep, Nipah virus (NiV) )
P506543 100 µg

Nipah virus/NiV N/Nucleo Protein (N-His-SUMO & C-Strep, Nipah virus (NiV) )

Sign In for Pricing
View Details
Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit
MBS2706084-01 24 Strip Well

Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit

Sign In for Pricing
View Details
Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit
MBS2706084-02 48 Strip Well

Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit

Sign In for Pricing
View Details
Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit
MBS2706084-03 96 Strip Well

Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit

Sign In for Pricing
View Details
Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit
MBS2706084-04 5x 96 Strip Well

Rat Tryptophan Hydroxylase 2 (TPH2) ELISA Kit

Sign In for Pricing
View Details