Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blmh Rabbit Polyclonal Antibody (FITC)

Blmh Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bh, Bmh, AI035728

UniProt

Q8R016

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Blmh

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848760

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human XRCC2 shRNA (UAS) - Lentiviral human XRCC2 shRNA (UAS, RFP) (100)
GTR15157032 1 Vial

Lentiviral human XRCC2 shRNA (UAS) - Lentiviral human XRCC2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Serine Protease Inhibitor Kazal-Type 2-Like Polyclonal Antibody
A56559-020 20 µL

Serine Protease Inhibitor Kazal-Type 2-Like Polyclonal Antibody

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 40 ELISA Kit
MBS3804355-01 48 Well

Human Soluble Cluster of Differentiation 40 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 40 ELISA Kit
MBS3804355-02 96 Well

Human Soluble Cluster of Differentiation 40 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 40 ELISA Kit
MBS3804355-03 5x 96 Well

Human Soluble Cluster of Differentiation 40 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 40 ELISA Kit
MBS3804355-04 10x 96 Well

Human Soluble Cluster of Differentiation 40 ELISA Kit

Sign In for Pricing
View Details