Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL5 Rabbit Polyclonal Antibody (HRP)

RPL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L5, uL18, MSTP030, PPP1R135

UniProt

P46777

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borealin Recombinant Protein Antigen
NBP1-89949PEP 0.1 mL

Borealin Recombinant Protein Antigen

Sign In for Pricing
View Details
Marburg Virus (FITC)
M2374-21-FITC 100 µL

Marburg Virus (FITC)

Sign In for Pricing
View Details
ABCD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]
TA803207AM 100 µL

ABCD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C12]

Sign In for Pricing
View Details
LHX6 (LIM Homeobox 6, LHX6.1, MGC119542, MGC119544, MGC119545) (MaxLight 650)
MBS6228529-01 0.1 mL

LHX6 (LIM Homeobox 6, LHX6.1, MGC119542, MGC119544, MGC119545) (MaxLight 650)

Sign In for Pricing
View Details
LHX6 (LIM Homeobox 6, LHX6.1, MGC119542, MGC119544, MGC119545) (MaxLight 650)
MBS6228529-02 5x 0.1 mL

LHX6 (LIM Homeobox 6, LHX6.1, MGC119542, MGC119544, MGC119545) (MaxLight 650)

Sign In for Pricing
View Details
O-tert-Butyl lysyl-tryptophyl-glycyl-lysinate
MBS5783368 Inquire

O-tert-Butyl lysyl-tryptophyl-glycyl-lysinate

Sign In for Pricing
View Details