Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL18 Rabbit Polyclonal Antibody (Biotin)

RPL18 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L18, DBA18

UniProt

Q07020

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr773 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV637995 1.0 µg DNA

Olr773 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TACI (Transmembrane Activator and CAML Interactor, CD267, CD267 Antigen, CVID, FLJ39942, MGC133214, MGC39952, OTTHUMP00000065442, Tumor Necrosis Factor Receptor 13B, Tumor Necrosis Factor Receptor Superfamily Member 13B, TNFRSF13B, TNFRSF13B Protein, TNFR
MBS6501979-01 0.1 mL

TACI (Transmembrane Activator and CAML Interactor, CD267, CD267 Antigen, CVID, FLJ39942, MGC133214, MGC39952, OTTHUMP00000065442, Tumor Necrosis Factor Receptor 13B, Tumor Necrosis Factor Receptor Superfamily Member 13B, TNFRSF13B, TNFRSF13B Protein, TNFR

Sign In for Pricing
View Details
TACI (Transmembrane Activator and CAML Interactor, CD267, CD267 Antigen, CVID, FLJ39942, MGC133214, MGC39952, OTTHUMP00000065442, Tumor Necrosis Factor Receptor 13B, Tumor Necrosis Factor Receptor Superfamily Member 13B, TNFRSF13B, TNFRSF13B Protein, TNFR
MBS6501979-02 5x 0.1 mL

TACI (Transmembrane Activator and CAML Interactor, CD267, CD267 Antigen, CVID, FLJ39942, MGC133214, MGC39952, OTTHUMP00000065442, Tumor Necrosis Factor Receptor 13B, Tumor Necrosis Factor Receptor Superfamily Member 13B, TNFRSF13B, TNFRSF13B Protein, TNFR

Sign In for Pricing
View Details
CD44 Antibody
orb1271840 1 mg

CD44 Antibody

Sign In for Pricing
View Details
Human DENND3 shRNA Plasmid
abx957853-01 150 µg

Human DENND3 shRNA Plasmid

Sign In for Pricing
View Details
Human DENND3 shRNA Plasmid
abx957853-02 300 µg

Human DENND3 shRNA Plasmid

Sign In for Pricing
View Details