Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL18 Rabbit Polyclonal Antibody (FITC)

RPL18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L18, DBA18

UniProt

Q07020

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRC18, CT (LRRC18, Leucine-rich repeat-containing protein 18) (MaxLight 650) discontinued
037919-ML650 100 µL

LRC18, CT (LRRC18, Leucine-rich repeat-containing protein 18) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Tert-Butyl 9-aminononanoate
JH914768 1 Each

Tert-Butyl 9-aminononanoate

Sign In for Pricing
View Details
HighFidelity Cy3 PCR Labeling Kit
orb1734988 10 rxn x 20 ul

HighFidelity Cy3 PCR Labeling Kit

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6383004-01 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6383004-02 5x 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Sign In for Pricing
View Details
GFAP Antibody
orb2322396-01 10 µg

GFAP Antibody

Sign In for Pricing
View Details