Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl17 Rabbit Polyclonal Antibody (HRP)

Rpl17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASI, rpL23

UniProt

P24049

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rpl17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_958818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRIMA812 Card Printers & Kits
321955 1 Box (1 Piece (s) x 1 Piece)

PRIMA812 Card Printers & Kits

Sign In for Pricing
View Details
SH3BP1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV638891 1.0 µg DNA

SH3BP1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (PE)
MBS6157375-01 0.1 mL

DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (PE)

Sign In for Pricing
View Details
DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (PE)
MBS6157375-02 5x 0.1 mL

DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (PE)

Sign In for Pricing
View Details
Human GPM6A (Neuronal membrane glycoprotein M6-a) ELISA Kit
EH8883 96 Tests

Human GPM6A (Neuronal membrane glycoprotein M6-a) ELISA Kit

Sign In for Pricing
View Details
Histone H4 Rabbit Polyclonal Antibody (Cy5.5)
orb1083048 100 µL

Histone H4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details