Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl27 Rabbit Polyclonal Antibody (HRP)

Rpl27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC103134

UniProt

Q5BLJ9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035419

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Purple sea urchin Integrin BC Antibody, Dylight550 Conjugate
DZ41486-Dylight550 200 µL

Anti-Purple sea urchin Integrin BC Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
Kizuna (Phospho-Thr379) Antibody
orb614371-01 50 μL

Kizuna (Phospho-Thr379) Antibody

Sign In for Pricing
View Details
Kizuna (Phospho-Thr379) Antibody
orb614371-02 100 µL

Kizuna (Phospho-Thr379) Antibody

Sign In for Pricing
View Details
Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit
MBS7209159-01 48 Well

Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit

Sign In for Pricing
View Details
Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit
MBS7209159-02 96 Well

Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit

Sign In for Pricing
View Details
Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit
MBS7209159-03 5x 96 Well

Goat Calcium-binding mitochondrial carrier protein SCaMC-3 (SLC25A23) ELISA Kit

Sign In for Pricing
View Details