Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL30 Rabbit Polyclonal Antibody (FITC)

RPL30 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L30

UniProt

P62888

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPL30

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000980

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf16 Rabbit Polyclonal Antibody (BF750)
orb2509205 100 µL

C2orf16 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit
MBS7206757-01 48 Well

Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit
MBS7206757-02 96 Well

Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit
MBS7206757-03 5x 96 Well

Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit

Sign In for Pricing
View Details
Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit
MBS7206757-04 10x 96 Well

Bovine Ankyrin repeat and SOCS box protein 2 (ASB2) ELISA Kit

Sign In for Pricing
View Details
PILRB Antibody, FITC conjugated
CSB-PA890735LC01HU-01 50 µg

PILRB Antibody, FITC conjugated

Sign In for Pricing
View Details