Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS3A Rabbit Polyclonal Antibody (Biotin)

RPS3A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S3A, FTE1, MFTL

UniProt

P61247

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS3A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

378 L Sinlge-Use Open bag -N
BIOBGBTLR0378S006 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

378 L Sinlge-Use Open bag -N

Sign In for Pricing
View Details
Interleukin 1 beta (IL1b, IL-1 beta, Catabolin, Hematopoietin 1, H1, IFN beta Inducing Factor, IL1F2, LAF, OAF, Osteoclast Activating Factor, Preinterleukin beta, Pro Interleukin 1 beta)
MBS6507790-01 0.1 mg

Interleukin 1 beta (IL1b, IL-1 beta, Catabolin, Hematopoietin 1, H1, IFN beta Inducing Factor, IL1F2, LAF, OAF, Osteoclast Activating Factor, Preinterleukin beta, Pro Interleukin 1 beta)

Sign In for Pricing
View Details
Interleukin 1 beta (IL1b, IL-1 beta, Catabolin, Hematopoietin 1, H1, IFN beta Inducing Factor, IL1F2, LAF, OAF, Osteoclast Activating Factor, Preinterleukin beta, Pro Interleukin 1 beta)
MBS6507790-02 5x 0.1 mg

Interleukin 1 beta (IL1b, IL-1 beta, Catabolin, Hematopoietin 1, H1, IFN beta Inducing Factor, IL1F2, LAF, OAF, Osteoclast Activating Factor, Preinterleukin beta, Pro Interleukin 1 beta)

Sign In for Pricing
View Details
Canine Microglia Primary Cells
CCEL90 5x 10^5 Cells/Vial

Canine Microglia Primary Cells

Sign In for Pricing
View Details
Anti-MASTL Antibody Picoband®, Dylight594 Conjugate
A04567-4-Dylight594 100 µg

Anti-MASTL Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Nori® Bovine 6-Plex ELISA Kits-Cardiac Panel
GR228034 96 Well

Nori® Bovine 6-Plex ELISA Kits-Cardiac Panel

Sign In for Pricing
View Details