Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS7 Rabbit Polyclonal Antibody (HRP)

RPS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S7, eS7, DBA8

UniProt

P62081

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Coagulation Factor II (F2)
TRV-0034780-01 20 µL

Monoclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor II (F2)
TRV-0034780-02 100 µL

Monoclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor II (F2)
TRV-0034780-03 200 µL

Monoclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor II (F2)
TRV-0034780-04 1 mL

Monoclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
ZNF460 Antibody
MBS9410443-01 0.05 mL

ZNF460 Antibody

Sign In for Pricing
View Details
ZNF460 Antibody
MBS9410443-02 0.1 mL

ZNF460 Antibody

Sign In for Pricing
View Details