Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS7 Rabbit Polyclonal Antibody (Biotin)

RPS7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S7, eS7, DBA8

UniProt

P62081

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETN (Resistin) Human ELISA Kit
G7495 96 Tests

RETN (Resistin) Human ELISA Kit

Sign In for Pricing
View Details
Bovine Heme Oxygenase 2, Decycling ELISA Kit
OM622317 96 Strip Well

Bovine Heme Oxygenase 2, Decycling ELISA Kit

Sign In for Pricing
View Details
Mouse CC16 (Clara Cell Protein 16) ELISA Kit
MBS8800644-01 48 Strip Well

Mouse CC16 (Clara Cell Protein 16) ELISA Kit

Sign In for Pricing
View Details
Mouse CC16 (Clara Cell Protein 16) ELISA Kit
MBS8800644-02 96 Strip Well

Mouse CC16 (Clara Cell Protein 16) ELISA Kit

Sign In for Pricing
View Details
Mouse CC16 (Clara Cell Protein 16) ELISA Kit
MBS8800644-03 5x 96 Strip Well

Mouse CC16 (Clara Cell Protein 16) ELISA Kit

Sign In for Pricing
View Details
Mouse CC16 (Clara Cell Protein 16) ELISA Kit
MBS8800644-04 10x 96 Strip Well

Mouse CC16 (Clara Cell Protein 16) ELISA Kit

Sign In for Pricing
View Details