Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tex11 Rabbit Polyclonal Antibody (Biotin)

Tex11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1560239

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tex11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCHTETNLSLYKNTVEKGIFHVLSYQAESAVAQGDFKKASICVLRCKDML

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001069708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBB Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716534 1.0 µg DNA

UBB Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Thymosin Alpha-1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0226R-BF594 100 µL

Thymosin Alpha-1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ARID3C Antibody - C-terminal region : FITC (ARP50384_P050-FITC)
ARP50384_P050-FITC 100 µL

ARID3C Antibody - C-terminal region : FITC (ARP50384_P050-FITC)

Sign In for Pricing
View Details
Recombinant Human CD3E & CD3G Heterodimer, C-Fc-His & C-Fc-Flag (Active)
AHC27705 100 μg

Recombinant Human CD3E & CD3G Heterodimer, C-Fc-His & C-Fc-Flag (Active)

Sign In for Pricing
View Details
RIMS2 (Regulating Synaptic Membrane Exocytosis Protein 2, Rab3-interacting Molecule 2, RIM 2, Rab-3-interacting Protein 3, KIAA0751, RAB3IP3, RIM2) (HRP)
132580-HRP 100 µL

RIMS2 (Regulating Synaptic Membrane Exocytosis Protein 2, Rab3-interacting Molecule 2, RIM 2, Rab-3-interacting Protein 3, KIAA0751, RAB3IP3, RIM2) (HRP)

Sign In for Pricing
View Details
PIGL siRNA Oligos set (Human)
36656171 3x 5 nmol

PIGL siRNA Oligos set (Human)

Sign In for Pricing
View Details