Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tex11 Rabbit Polyclonal Antibody (FITC)

Tex11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1560239

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tex11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCHTETNLSLYKNTVEKGIFHVLSYQAESAVAQGDFKKASICVLRCKDML

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001069708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pachytene checkpoint protein 2 homolog (TRIP13) Chicken ELISA Kit
F6556 96 Tests

Pachytene checkpoint protein 2 homolog (TRIP13) Chicken ELISA Kit

Sign In for Pricing
View Details
STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 405) discontinued
S7973-59H-ML405 100 µL

STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Cxxc5 Rabbit Polyclonal Antibody (Biotin)
orb2099584 100 µL

Cxxc5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
OAS1 Polyclonal Antibody
E-AB-90909-01 60 µL

OAS1 Polyclonal Antibody

Sign In for Pricing
View Details
OAS1 Polyclonal Antibody
E-AB-90909-02 120 µL

OAS1 Polyclonal Antibody

Sign In for Pricing
View Details
OAS1 Polyclonal Antibody
E-AB-90909-03 200 µL

OAS1 Polyclonal Antibody

Sign In for Pricing
View Details