Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFD2L Rabbit Polyclonal Antibody (Biotin)

MTHFD2L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ13105, MGC45532, MGC72244

UniProt

Q9H903

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MTHFD2L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHOD1 Human shRNA Plasmid Kit (Locus ID 29109)
TL312981 1 Kit

FHOD1 Human shRNA Plasmid Kit (Locus ID 29109)

Sign In for Pricing
View Details
BAX (NM_004324) Human Tagged ORF Clone Lentiviral Particle
RC219954L3V 200 µL

BAX (NM_004324) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr1061 3'UTR GFP Stable Cell Line
TU264429 1.0 mL

Olr1061 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-ABHD2 Antibody
STJ500015 100 µg

Anti-ABHD2 Antibody

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Putative nickel-responsive regulator (AF_0743)
MBS1112001-01 0.02 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Putative nickel-responsive regulator (AF_0743)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Putative nickel-responsive regulator (AF_0743)
MBS1112001-02 0.1 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Putative nickel-responsive regulator (AF_0743)

Sign In for Pricing
View Details