Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFD2L Rabbit Polyclonal Antibody (HRP)

MTHFD2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ13105, MGC45532, MGC72244

UniProt

Q9H903

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MTHFD2L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHRL (Appetite-regulating Hormone, Growth Hormone Secretagogue, Growth Hormone-releasing Peptide, Motilin-related Peptide, Protein M46, MTLRP, UNQ524/PRO1066) (Biotin)
127298-Biotin 100 µL

GHRL (Appetite-regulating Hormone, Growth Hormone Secretagogue, Growth Hormone-releasing Peptide, Motilin-related Peptide, Protein M46, MTLRP, UNQ524/PRO1066) (Biotin)

Sign In for Pricing
View Details
(R) -BAY-899
T62881 2 mg

(R) -BAY-899

Sign In for Pricing
View Details
Platelet/Endothelial Cell Adhesion Molecule (PECAM1) Mouse ELISA Kit
C2315 96 Tests

Platelet/Endothelial Cell Adhesion Molecule (PECAM1) Mouse ELISA Kit

Sign In for Pricing
View Details
CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)
138509-01 20 µg

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)

Sign In for Pricing
View Details
CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)
138509-02 100 µg

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)

Sign In for Pricing
View Details
Thiohomo Sildenafil
021753 5 mg

Thiohomo Sildenafil

Sign In for Pricing
View Details