Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRARP Rabbit Polyclonal Antibody (Biotin)

NRARP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC61598

UniProt

Q7Z6K4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NRARP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ralgds shRNA (UAS) - Lentiviral mouse Ralgds shRNA (UAS, iRFP) plasmid
GTR15268468 1 Vial

Lentiviral mouse Ralgds shRNA (UAS) - Lentiviral mouse Ralgds shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PTEN, CT (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1) (MaxLight 750) discontinued
P9182-01R-ML750 100 µL

PTEN, CT (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
UGT2B10 siRNA (Human)
CRH5036-01 15 nmol

UGT2B10 siRNA (Human)

Sign In for Pricing
View Details
UGT2B10 siRNA (Human)
CRH5036-02 30 nmol

UGT2B10 siRNA (Human)

Sign In for Pricing
View Details
Horse Blood Lysed 100mL
MED1316 1 Each

Horse Blood Lysed 100mL

Sign In for Pricing
View Details
Mouse Smgc qPCR Primer Pair
QM57070S 200 Tests

Mouse Smgc qPCR Primer Pair

Sign In for Pricing
View Details